Loading...
Statistics
Luxury Bed and Breakfast Hawes, Guest houses Hawes, B&B in Hawes
www.thegarsdale.com/
Beautiful guest accommodation near Hawes. AA 4-Star Gold & Breakfast Award, Luxury accommodation in a beautiful location. 01969 667096
Thegarsdale.com
Thegarsdale.com is hosted in
United Kingdom
.
Thegarsdale.com uses HTTPS protocol.
Number of used technologies:
5.
First technologies:
CSS, Html, Html5,
Number of used javascripts: 7.
First javascripts:
Jquery.js, Redirect.js, Www.js,
Number of used analytics tools:
1.
First analytics tools:
Google Analytics,
Its server type is:
Apache/2.4.18 (Unix).
Technologies in use by Thegarsdale.com
Technology
Number of occurences: 5
- CSS
- Html
- Html5
- Javascript
- jQuery
Advertisement
Javascripts
Number of occurences: 7
- jquery.js
- redirect.js
- www.js
- eviivo.searchbox.resource.js
- jsMenu.js
Analytics
Number of occurences: 1
- Google Analytics
Server Type
- Apache/2.4.18 (Unix)
Conversion rate optimization |
|
|---|---|
Clickable call number
|
Not founded! |
|
Conversion form (contact form, subcriber)
|
Not founded! |
|
Clickable email
|
Not founded! |
|
CTA (call to action) button
|
Not founded! |
|
List
|
Founded! |
|
Image
|
Not founded! |
|
Enhancement
|
Not founded! |
|
Responsive website
|
Founded! |
|
Facebook sharing
|
Not founded! |
|
Google+ sharing
|
Not founded! |
|
Twitter sharing
|
Not founded! |
|
Linkedin sharing
|
Not founded! |
|
Blog on the webiste
|
Not founded! |
HTTPS (SSL) - Thegarsdale.com
SSL certificate
- name: /OU=Domain Control Validated/CN=*.secure-secure.co.uk
- subject:
- OU: Domain Control Validated
- CN: *.secure-secure.co.uk
- hash: 05894cd2
- issuer:
- C: BE
- O: GlobalSign nv-sa
- CN: GlobalSign Domain Validation CA - SHA256 - G2
- version: 2
- serialNumber: 1492208244245080359488883509239508541224455
- validFrom: 140410074728Z
- validTo: 180110143703Z
- validFrom_time_t: 1397116048
- validTo_time_t: 1515595023
- extensions:
- keyUsage: Digital Signature, Key Encipherment
- certificatePolicies: Policy: 2.23.140.1.2.1 CPS: https://www.globalsign.com/repository/
- subjectAltName: DNS:*.secure-secure.co.uk, DNS:secure-secure.co.uk
- basicConstraints: CA:FALSE
- extendedKeyUsage: TLS Web Server Authentication, TLS Web Client Authentication
- crlDistributionPoints: Full Name: URI:http://crl.globalsign.com/gs/gsdomainvalsha2g2.crl
- authorityInfoAccess: CA Issuers - URI:http://secure.globalsign.com/cacert/gsdomainvalsha2g2r1.crt OCSP - URI:http://ocsp2.globalsign.com/gsdomainvalsha2g2
- subjectKeyIdentifier: 48:1D:3E:03:0D:A9:85:F3:2B:EB:B6:98:19:79:2F:F1:7D:76:B4:B4
- authorityKeyIdentifier: keyid:EA:4E:7C:D4:80:2D:E5:15:81:86:26:8C:82:6D:C0:98:A4:CF:97:0F
Number of occurences: 11
- Name:
Content: en-gb - Name: google-site-verification
Content: UpfutKm_HF4ZiTU8joepzW-O7FjFK0EjEgk4CH9YovE - Name: msvalidate.01
Content: CC2BA531D724D959404BD2C16A270661 - Name: generator
Content: Serif WebPlus X7 (15,0,4,38) - Name: viewport
Content: width=950 - Name: keywords
Content: 3 nights B&B for 2 winter offer 2 LA105PU, LA10 5PU,B&B in Hawes,B&B Garsdale,garsdale train station,Garsdale head B&B,Bed and Breakfast in Hawes,guest house hawes,Luxury bed and breakfast hawes,places to stay in hawes,bed and breakfast near garsdale train station,b&b at garsdale, Bed and breakfast on the pennine bridleway,guest accommodation in the dales,walking the the dales,walking in hawes,the laddy anne walk,bed and breakfast on the dalesway,bed and breakfast near keld,accommodation near muker,yorkshire dales bed and breakfast,accommodation in the yorkshire dales,bed and breakfast near hawes,, The garsdale B&B 3 nights for the price of 2 winter offer,the garsdale luxury bed and breakfast,the garsdale B&B.bed and breakfast cowgill,garsdale bed and breakfast,garsdale accommodation,b&b garsdale train station,hawes bed and breakfast,hawes B&B,b&B near hawes,B&B in hawes,hawes b&b north yorkshire,hawes b&b accommodation,hawes b&b yorkshire dales,hawes bed and breakfast,hawes hawes bed and breakfast accommodation,hawes bed and breakfast accommodation yorkshire dales,hawes accommodation dog friendly,bed and breakfast in the yorkshire dales,bed and breakfast in the yorkshire dales dog friendly,bed and breakfast in bainbridge,bed and breakfast bainbridge yorkshire,bed and breakfast hardraw,bed and breakfast in garsdale,bed and breakfast in sedbergh,bed and breakfast in keld,bed and breakfast near thwaite,bed and breakfast near keld,B and B in Hawes,LA105PU,Bed and Breakfast in Hawes,Bed and Breakfast in Wensleydale,Bed and Breakfast in Sedbergh,Bed and breakfast in Garsdale,Guest houses in Hawes,Guest houses in Wensleydale,Guesthouses in Sedbergh,Guest Houses in Sedbergh,Guest Houses near Simonstone Hall,Bed and breakfast in Garsdale,Garsdale train station,events in hawes area,event in wensleydale, - Name: description
Content: Beautiful guest accommodation near Hawes. AA 4-Star Gold & Breakfast Award, Luxury accommodation in a beautiful location. 01969 667096 - Name: author
Content: Peter C Smith - Name: copyright
Content: © - Name: date
Content: 2015-11-05T16:34:06+00:00 - Name: robots
Content: index,follow
Server / Hosting
- IP: 79.170.44.88
- Latitude: 51.50
- Longitude: -0.12
- Country: United Kingdom
Rname
- ns.mainnameserver.com
- ns2.mainnameserver.com
- mail.thegarsdale.com
Target
- hostmaster.mainnameserver.com
HTTP Header Response
HTTP/1.1 301 Moved Permanently
Date: Mon, 11 Apr 2016 03:36:18 GMT
Server: Apache/2.4.18 (Unix)
Location: http://www.thegarsdale.com/
Content-Type: text/html; charset=iso-8859-1
HTTP/1.1 200 OK
Date: Mon, 11 Apr 2016 03:36:18 GMT
Server: Apache/2.4.18 (Unix)
Last-Modified: Thu, 05 Nov 2015 16:36:36 GMT
ETag: "cbcf-523cdbb0ab577"
Accept-Ranges: bytes
Content-Length: 52175
Content-Type: text/html
DNS
host: thegarsdale.com
- class: IN
- ttl: 10800
- type: A
- ip: 79.170.44.88
host: thegarsdale.com
- class: IN
- ttl: 10800
- type: NS
- target: ns.mainnameserver.com
host: thegarsdale.com
- class: IN
- ttl: 10800
- type: NS
- target: ns2.mainnameserver.com
host: thegarsdale.com
- class: IN
- ttl: 10800
- type: SOA
- mname: ns.mainnameserver.com
- rname: hostmaster.mainnameserver.com
- serial: 2012091269
- refresh: 86400
- retry: 604800
- expire: 2419200
- minimum-ttl: 10800
host: thegarsdale.com
- class: IN
- ttl: 10800
- type: MX
- pri: 10
- target: mail.thegarsdale.com
Common Typos/Mistakes
This list shows You some spelling mistakes at internet search for this domain.
www.hegarsdale.com, www.tqhegarsdale.com, www.qhegarsdale.com, www.tahegarsdale.com, www.ahegarsdale.com, www.t hegarsdale.com, www. hegarsdale.com, www.twhegarsdale.com, www.whegarsdale.com, www.tehegarsdale.com, www.ehegarsdale.com, www.tzhegarsdale.com, www.zhegarsdale.com, www.txhegarsdale.com, www.xhegarsdale.com, www.tchegarsdale.com, www.chegarsdale.com, www.tegarsdale.com, www.theegarsdale.com, www.teegarsdale.com, www.thdegarsdale.com, www.tdegarsdale.com, www.thcegarsdale.com, www.tcegarsdale.com, www.thuegarsdale.com, www.tuegarsdale.com, www.thjegarsdale.com, www.tjegarsdale.com, www.thegarsdale.com, www.tegarsdale.com, www.thbegarsdale.com, www.tbegarsdale.com, www.thgegarsdale.com, www.tgegarsdale.com, www.thgarsdale.com, www.thexgarsdale.com, www.thxgarsdale.com, www.thesgarsdale.com, www.thsgarsdale.com, www.thewgarsdale.com, www.thwgarsdale.com, www.thergarsdale.com, www.thrgarsdale.com, www.thefgarsdale.com, www.thfgarsdale.com, www.thevgarsdale.com, www.thvgarsdale.com, www.thecgarsdale.com, www.thcgarsdale.com, www.theqgarsdale.com, www.thqgarsdale.com, www.theagarsdale.com, www.thagarsdale.com, www.theygarsdale.com, www.thygarsdale.com, www.thearsdale.com, www.thegsarsdale.com, www.thesarsdale.com, www.thegxarsdale.com, www.thexarsdale.com, www.thegyarsdale.com, www.theyarsdale.com, www.thegharsdale.com, www.theharsdale.com, www.thegnarsdale.com, www.thenarsdale.com, www.thegcarsdale.com, www.thecarsdale.com, www.thegdarsdale.com, www.thedarsdale.com, www.thegearsdale.com, www.theearsdale.com, www.thegrarsdale.com, www.therarsdale.com, www.thegtarsdale.com, www.thetarsdale.com, www.thegbarsdale.com, www.thebarsdale.com, www.thegvarsdale.com, www.thevarsdale.com, www.thegrsdale.com, www.thegaorsdale.com, www.thegorsdale.com, www.thegaprsdale.com, www.thegprsdale.com, www.thega9rsdale.com, www.theg9rsdale.com, www.thegarsdale.com, www.thegrsdale.com, www.thegairsdale.com, www.thegirsdale.com, www.thegaursdale.com, www.thegursdale.com, www.thegasdale.com, www.thegarisdale.com, www.thegaisdale.com, www.thegarosdale.com, www.thegaosdale.com, www.thegarlsdale.com, www.thegalsdale.com, www.thegarlsdale.com, www.thegalsdale.com, www.thegar.sdale.com, www.thega.sdale.com, www.thegardale.com, www.thegarsedale.com, www.thegaredale.com, www.thegarswdale.com, www.thegarwdale.com, www.thegarsddale.com, www.thegarddale.com, www.thegarsxdale.com, www.thegarxdale.com, www.thegarsfdale.com, www.thegarfdale.com, www.thegarsgdale.com, www.thegargdale.com, www.thegarstdale.com, www.thegartdale.com, www.thegarsale.com, www.thegarsdtale.com, www.thegarstale.com, www.thegarsdgale.com, www.thegarsgale.com, www.thegarsdbale.com, www.thegarsbale.com, www.thegarsdxale.com, www.thegarsxale.com, www.thegarsdsale.com, www.thegarssale.com, www.thegarsdfale.com, www.thegarsfale.com, www.thegarsdvale.com, www.thegarsvale.com, www.thegarsdyale.com, www.thegarsyale.com, www.thegarsdzale.com, www.thegarszale.com, www.thegarsdaale.com, www.thegarsaale.com, www.thegarsdeale.com, www.thegarseale.com, www.thegarsdrale.com, www.thegarsrale.com, www.thegarsdle.com, www.thegarsdaole.com, www.thegarsdole.com, www.thegarsdaple.com, www.thegarsdple.com, www.thegarsda9le.com, www.thegarsd9le.com, www.thegarsdale.com, www.thegarsdle.com, www.thegarsdaile.com, www.thegarsdile.com, www.thegarsdaule.com, www.thegarsdule.com, www.thegarsdae.com, www.thegarsdalue.com, www.thegarsdaue.com, www.thegarsdal8e.com, www.thegarsda8e.com, www.thegarsdal9e.com, www.thegarsda9e.com, www.thegarsdalje.com, www.thegarsdaje.com, www.thegarsdal0e.com, www.thegarsda0e.com, www.thegarsdalme.com, www.thegarsdame.com, www.thegarsdalpe.com, www.thegarsdape.com, www.thegarsdaloe.com, www.thegarsdaoe.com,
Other websites we recently analyzed
- risperdaltardivedyskinesialawsuit.com
Albuquerque (United States) - 129.121.40.24
Server software: nginx
Technology: Html
Number of meta tags: 1 - gns.no
Norway - 91.221.130.155
Server software: Apache
Technology: Html, Php - systemsshopper.com - Diese Website steht zum Verkauf! - Informationen zum Thema computer home audio.
DieseCambridge (United States) - 72.52.4.119
Server software: Apache/2.2.22 (Debian)
Technology: Google Adsense, Html, Html5, Javascript, Php
Number of Javascript: 3
Number of meta tags: 5 - Global Future Ltd.
Scottsdale (United States) - 184.168.224.170
Server software: Microsoft-IIS/8.0
Technology: CSS, Flexslider, Html, Iframe, Javascript
Number of Javascript: 4
Number of meta tags: 3 - Webdesign Komplettpaket zum Festpreis - für alle Branchen!
Sie suchen ein Webdesign im Paket zum Komplettpreis? Wählen Sie in nur 3 Schritten Ihr Komplettpaket - für alle Branchen! Professionell & günstig!France - 5.196.189.250
G Analytics ID: UA-20632638-14
Server software: Apache/2.2.16 (Debian)
Technology: CSS, Flexslider, Font Awesome, Google Font API, Html, Html5, Javascript, jQuery, Php, Pingback, Revslider, Shortcodes, Google Analytics, Wordpress
Number of Javascript: 20
Number of meta tags: 5 - âºâºIتبادل لینک Ù„Øظه ای (رنک 3 Ú¯ÙˆÚ¯Ù„)Iâºâº
✚تبادل لینک Ù„Øظه ای (رنک 3 Ú¯ÙˆÚ¯Ù„)✚✯همین Øالا اینجا کلیک کنید Ùˆ در 5 ثانیه تبادل لینک کنید Ùˆ سایت یا وبلاگتان را به همه معرÙÛŒ کنید✯✚تبادل لینک Ù„Øظه ای (رنک 3 Ú¯ÙˆÚ¯Ù„)✚Los Angeles (United States) - 192.69.200.139
G Analytics ID: UA-17583324-3
Server software: squid/3.5.14
Technology: CSS, Html, Javascript, Google Analytics
Number of Javascript: 2
Number of meta tags: 3 - Colerain RV | Cincinnati RV Dealer | Dayton RV Sales | Indianapolis RV Dealer | Delaware RV Dealer
Colerain RV is here to service all of your camping needs. Located in Cincinnati & Dayton Ohio, & Indianapolis, Indiana, we offer a variety of Travel Trailers, 5th wheels & Motor Homes as well as the largest parts & service department in the Midwest!Orlando (United States) - 72.29.69.47
Server software: Microsoft-IIS/7.5
Technology: BootstrapCDN, AJAX Libraries API, CSS, Font Awesome, Html, Iframe, Javascript, jQuery, jQuery Cycle, jQuery Fancybox, jQuery UI, Php, SVG, Google Analytics, Google AdWords Conversion Tracking, Google Tagmanager, Facebook Like button, Facebook Box, Twitter Button
Number of Javascript: 23
Number of meta tags: 9 - The Precise Definition of Reason
What is Reason? is the most important question a man can ask himselfUnited Kingdom - 83.223.106.30
Server software: Apache
Technology: CSS, Html
Number of Javascript: 1
Number of meta tags: 4 - trend-bender åæ½®æ— trend-bender.com
trend-bender åæ½®æ— trend-bender.comLas Vegas (United States) - 70.39.84.250
Server software:
Technology: CSS, Html, jQuery
Number of Javascript: 1
Number of meta tags: 3 - Willkommen bei Scuderia Magra - Scuderia Magra Motorsportclub München e.V.
Scuderia Magra Motorsportclub München e.V.Germany - 217.160.223.246
Server software: Apache
Technology: CSS, Google Font API, Html, Html5, Javascript, Php
Number of Javascript: 5
Number of meta tags: 5